Anti-L3MBTL1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10056-100
Article Name: Anti-L3MBTL1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10056-100
Supplier Catalog Number: A10056-100
Alternative Catalog Number: ABC-A10056-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 533-772 of human L3MBTL1 (NP_056293.4).
Conjugation: Unconjugated
Rabbit polyclonal antibody to L3MBTL1.
Clonality: Polyclonal
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: PLSYRSLPHTRTSKYSFHHRKCPTPGCDGSGHVTGKFTAHHCLSGCPLAERNQSRLKAELSDSEASARKKNLSGFSPRKKPRHHGRIGRPPKYRKIPQEDFQTLTPDVVHQSLFMSALSAHPDRSLSVCWEQHCKLLPGVAGISASTVAKWTIDEVFGFVQTLTGCEDQARLFKDEARIVRVTHVSGKTLVWTVAQLGDLVCSDHLQEGKGILETGVHSLLCSLPTHLLAKLSFASDSQY
Target: L3MBTL1
Antibody Type: Primary Antibody
Application Dilute: ICC/IF: 1:50-1:100