Anti-TMPRSS2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A13784-100
Article Name: Anti-TMPRSS2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A13784-100
Supplier Catalog Number: A13784-100
Alternative Catalog Number: ABC-A13784-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TMPRSS2 (NP_005647.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to TMPRSS2.
Clonality: Polyclonal
Molecular Weight: 70 kDa / 32 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAAL
Target: TMPRSS2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200