Recombinant SARS-CoV-2 Spike Protein (B.1.617.2 Variant) (Functional)

Product Overview

• Article Name: Recombinant SARS-CoV-2 Spike Protein (B.1.617.2 Variant) (Functional)
• Biozol Catalog Number: ABC-A270599-100
• Supplier Catalog Number: A270599-100
• Alternative Catalog Number: ABC-A270599-100
• Manufacturer: Antibodies.com
• Category: Proteine/Peptide
• Application: Functional Studies, IA, SDS-PAGE, WB
• Alternative Names: sars-cov-2

Product Description

Full-length soluble protein with foldon trimerization motif, mutated Furin recognition site and 6 stabilising mutations (F817P, A892P, A899P, A942P, K986P and V987P), based on/modified from Amanat et al, 2020 (PMID: 32398876) and Hsieh et al, 2020 (PMID:

Product Properties

• Concentration: Lot specific.
• Tag: His Tag (8xHis at the C-terminus).
• Buffer: Supplied in Phosphate Buffered Saline with 20% Glycerol.
• Expression System: HEK293 cells.
• Purity: > 95% (by SDS-PAGE).
• Form: Liquid
• Sequence: VNLRTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLDVYYHKNNKSWMESGVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQ
• Target: SARS-CoV-2 Spike Protein