Anti-SARS-CoV-2 Spike Glycoprotein S2 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A305449-100
Article Name: |
Anti-SARS-CoV-2 Spike Glycoprotein S2 Antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
ABC-A305449-100 |
Supplier Catalog Number: |
A305449-100 |
Alternative Catalog Number: |
ABC-A305449-100 |
Manufacturer: |
Antibodies.com |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IP, WB |
Species Reactivity: |
Virus |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1174-1273 of SARS-CoV-2 Spike S2 (YP_009724390.1). |
Conjugation: |
Unconjugated |
Rabbit polyclonal antibody to SARS-CoV-2 Spike Glycoprotein S2. |
Clonality: |
Polyclonal |
Molecular Weight: |
36 kDa |
Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
Form: |
Liquid |
Sequence: |
ASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT |
Target: |
SARS-CoV-2 Spike Glycoprotein S2 |
Antibody Type: |
Primary Antibody |
Application Dilute: |
WB: 1:500-1:1,000, IP: 1:1,000-1:5,000 |