Anti-SARS-CoV-2 Spike Glycoprotein S2 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A305449-100
| Article Name: |
Anti-SARS-CoV-2 Spike Glycoprotein S2 Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A305449-100 |
| Supplier Catalog Number: |
A305449-100 |
| Alternative Catalog Number: |
ABC-A305449-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IP, WB |
| Species Reactivity: |
Virus |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1174-1273 of SARS-CoV-2 Spike S2 (YP_009724390.1). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to SARS-CoV-2 Spike Glycoprotein S2. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
36 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Form: |
Liquid |
| Sequence: |
ASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT |
| Target: |
SARS-CoV-2 Spike Glycoprotein S2 |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:500-1:1,000, IP: 1:1,000-1:5,000 |
