Anti-SARS-CoV-2 ORF7a Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A305756-100
| Article Name: |
Anti-SARS-CoV-2 ORF7a Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A305756-100 |
| Supplier Catalog Number: |
A305756-100 |
| Alternative Catalog Number: |
ABC-A305756-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Virus |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of coronavirus ORF7a (YP_009724395.1). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to SARS-CoV-2 ORF7a. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
17 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Form: |
Liquid |
| Sequence: |
ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYS |
| Target: |
SARS-CoV-2 ORF7a |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:500-1:1,000 |
