Anti-SARS-CoV-2 Spike Glycoprotein S1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A307320-100
Article Name: Anti-SARS-CoV-2 Spike Glycoprotein S1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A307320-100
Supplier Catalog Number: A307320-100
Alternative Catalog Number: ABC-A307320-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Virus
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of coronavirus Spike S1 (NP_828851.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to SARS-CoV-2 Spike Glycoprotein S1.
Clonality: Polyclonal
Molecular Weight: 200 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRG
Target: SARS-CoV-2 Spike Glycoprotein S1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000