Recombinant Human ACE2 (Biotin) Protein (C-terminal His + Avi Tag)

Product Overview

• Article Name: Recombinant Human ACE2 (Biotin) Protein (C-terminal His + Avi Tag)
• Biozol Catalog Number: ABC-A325688-50
• Supplier Catalog Number: A325688-50
• Alternative Catalog Number: ABC-A325688-50
• Manufacturer: Antibodies.com
• Category: Proteine/Peptide
• Application: ELISA
• Conjugation: Biotin

Product Properties

• Concentration: Lot Specific
• Tag: C-terminal His + Avi Tag
• Buffer: Supplied in 50 mM Tris Buffer, pH 7.5, with 150 mM Sodium Chloride and 20% Glycerol.
• Expression System: HEK 293 cells
• Purity: >90% as determined by SDS-PAGE.
• Form: Liquid
• Sequence: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMW
• Target: ACE2