OTOR Human

Catalog Number: ABC-A61792-1
Article Name: OTOR Human
Biozol Catalog Number: ABC-A61792-1
Supplier Catalog Number: A61792-1
Alternative Catalog Number: ABC-A61792-1
Manufacturer: Antibodies.com
Category: Proteine/Peptide
Otoraplin Human Recombinant
Buffer: The OTOR protein was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 130mM NaCl.
Source: Escherichia Coli.
Purity: Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE.
Target: OTOR