OTOR Human
Catalog Number:
ABC-A61792-20
| Article Name: |
OTOR Human |
| Biozol Catalog Number: |
ABC-A61792-20 |
| Supplier Catalog Number: |
A61792-20 |
| Alternative Catalog Number: |
ABC-A61792-20 |
| Manufacturer: |
Antibodies.com |
| Category: |
Proteine/Peptide |
| Otoraplin Human Recombinant |
| Buffer: |
The OTOR protein was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 130mM NaCl. |
| Source: |
Escherichia Coli. |
| Purity: |
Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Form: |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: |
VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE. |
| Target: |
OTOR |
