Anti-TREM2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A8628-100
Article Name: Anti-TREM2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A8628-100
Supplier Catalog Number: A8628-100
Alternative Catalog Number: ABC-A8628-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-161 of human TREM2 (NP_061838.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to TREM2.
Clonality: Polyclonal
Molecular Weight: 30 - 50 kDa / 28 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISR
Target: TREM2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200