Anti-TRIM31 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A8699-50
Article Name: Anti-TRIM31 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A8699-50
Supplier Catalog Number: A8699-50
Alternative Catalog Number: ABC-A8699-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 186-425 of human TRIM31 (NP_008959.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to TRIM31.
Clonality: Polyclonal
Molecular Weight: 48 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: ELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFCEVPSS
Target: TRIM31
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200