Anti-CACNA1H Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A8755-100
Article Name: Anti-CACNA1H Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A8755-100
Supplier Catalog Number: A8755-100
Alternative Catalog Number: ABC-A8755-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1890-2030 of human CACNA1H (NP_066921.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to CACNA1H.
Clonality: Polyclonal
Molecular Weight: 259 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: SARRVDADRPPLPQESPGARDAPNLVARKVSVSRMLSLPNDSYMFRPVVPASAPHPRPLQEVEMETYGAGTPLGSVASVHSPPAESCASLQIPLAVSSPARSGEPLHALSPRGTARSPSLSRLLCRQEAVHTDSLEGKIDS
Target: CACNA1H
Antibody Type: Primary Antibody
Application Dilute: ICC/IF: 1:50-1:200