Anti-CRB1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A8756-100
Article Name: Anti-CRB1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A8756-100
Supplier Catalog Number: A8756-100
Alternative Catalog Number: ABC-A8756-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 28-133 of human CRB1 (NP_957705.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to CRB1.
Clonality: Polyclonal
Molecular Weight: 150 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: NKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPV
Target: CRB1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC: 1:50-1:200