Anti-UNG Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87570-100
Article Name: Anti-UNG Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87570-100
Supplier Catalog Number: A87570-100
Alternative Catalog Number: ABC-A87570-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UNG (NP_550433.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to UNG.
Clonality: Polyclonal
Molecular Weight: 38 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKK
Target: UNG
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:100