Anti-SEPN1 / SELN Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87582-100
Article Name: Anti-SEPN1 / SELN Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87582-100
Supplier Catalog Number: A87582-100
Alternative Catalog Number: ABC-A87582-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 341-590 of human SEPN1 (NP_065184.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to SEPN1 / SELN.
Clonality: Polyclonal
Molecular Weight: 66 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: VDMEWLYGASESSNMEVDIGYIPQMELEATGPSVPSVILDEDGSMIDSHLPSGEPLQFVFEEIKWQQELSWEEAARRLEVAMYPFKKVSYLPFTEAFDRAKAENKLVHSILLWGALDDQSCUGSGRTLRETVLESSPILTLLNESFISTWSLVKELEELQNNQENSSHQKLAGLHLEKYSFPVEMMICLPNGTVVHHINANYFLDITSVKPEEIESNLFSFSSTFEDPSTATYMQFLKEGLRRGLPLLQP
Target: SEPN1 / SELN
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000