Anti-FSTL5 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87597-100
Article Name: Anti-FSTL5 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87597-100
Supplier Catalog Number: A87597-100
Alternative Catalog Number: ABC-A87597-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-250 of human FSTL5 (NP_064501.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to FSTL5.
Clonality: Polyclonal
Molecular Weight: 93 - 100 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: RPTKEGGYGLKSYQPLMRLRHKQEKNQESSRVKGFMIQDGPFGSCENKYCGLGRHCVTSRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVHRAACLKKQKITIVHNEDCFFKGDKCKTTEYSKMKNMLLDLQNQKYIMQENENPNGDDISRKKLLVDQMFKYFDADSNGLVDINELTQVIKQEELGKDLFDCTLYVLLKYDDFNADKHLALEEFYRAFQVIQLSLP
Target: FSTL5
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200