Anti-LAMP2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87608-100
Article Name: Anti-LAMP2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87608-100
Supplier Catalog Number: A87608-100
Alternative Catalog Number: ABC-A87608-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, IP, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 59-263 of human LAMP2 (NP_002285.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to LAMP2.
Clonality: Polyclonal
Molecular Weight: 100 - 130 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: KTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTG
Target: LAMP2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC: 1:50-1:200, IP: 1:50-1:200