Anti-Raptor Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87611-100
Article Name: Anti-Raptor Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87611-100
Supplier Catalog Number: A87611-100
Alternative Catalog Number: ABC-A87611-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 888-1013 of human RPTOR (NP_065812.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Raptor.
Clonality: Polyclonal
Molecular Weight: 140 - 150 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: LTNDVAKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRL
Target: Raptor
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200