Anti-MRPS14 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87619-100
Article Name: Anti-MRPS14 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87619-100
Supplier Catalog Number: A87619-100
Alternative Catalog Number: ABC-A87619-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPS14 (NP_071383.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to MRPS14.
Clonality: Polyclonal
Molecular Weight: 15 - 17 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW
Target: MRPS14
Antibody Type: Primary Antibody
Application Dilute: WB: 1:200-1:2,000, ICC/IF: 1:50-1:200