Anti-ZNF581 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87624-100
Article Name: Anti-ZNF581 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87624-100
Supplier Catalog Number: A87624-100
Alternative Catalog Number: ABC-A87624-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ZNF581 (NP_057619.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to ZNF581.
Clonality: Polyclonal
Molecular Weight: 22 - 24 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCP
Target: ZNF581
Antibody Type: Primary Antibody
Application Dilute: WB: 1:1,000-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200