Anti-CD3 epsilon Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87625-100
Article Name: Anti-CD3 epsilon Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87625-100
Supplier Catalog Number: A87625-100
Alternative Catalog Number: ABC-A87625-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CD3E Antigen (NP_000724.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to CD3 epsilon.
Clonality: Polyclonal
Molecular Weight: 23 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: PRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Target: CD3 epsilon
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200