Anti-GSTM5 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87628-100
Article Name: Anti-GSTM5 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87628-100
Supplier Catalog Number: A87628-100
Alternative Catalog Number: ABC-A87628-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human GSTM5 (NP_000842.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to GSTM5.
Clonality: Polyclonal
Molecular Weight: 24 - 26 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: LENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
Target: GSTM5
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:100