Anti-CISH / CIS Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87630-100
Article Name: Anti-CISH / CIS Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87630-100
Supplier Catalog Number: A87630-100
Alternative Catalog Number: ABC-A87630-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 17-130 of human CISH (NP_659508.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to CISH / CIS.
Clonality: Polyclonal
Molecular Weight: 37 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: TGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVR
Target: CISH / CIS
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200