Anti-BST2 / Tetherin Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87641-100
Article Name: Anti-BST2 / Tetherin Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87641-100
Supplier Catalog Number: A87641-100
Alternative Catalog Number: ABC-A87641-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 49-161 of human BST2 (NP_004326.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to BST2 / Tetherin.
Clonality: Polyclonal
Molecular Weight: 35 - 40 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Target: BST2 / Tetherin
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200