Anti-EZH2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87887-100
Article Name: Anti-EZH2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87887-100
Supplier Catalog Number: A87887-100
Alternative Catalog Number: ABC-A87887-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IP, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human EZH2/KMT6 (NP_001190176.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to EZH2.
Clonality: Polyclonal
Molecular Weight: 105 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: LERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELI
Target: EZH2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IP: 1:50-1:100