Anti-TRPC6 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87901-100
Article Name: Anti-TRPC6 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87901-100
Supplier Catalog Number: A87901-100
Alternative Catalog Number: ABC-A87901-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 732-931 of human TRPC6 (NP_004612.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to TRPC6.
Clonality: Polyclonal
Molecular Weight: 110 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: QEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSLFYLLLKLKKWISELFQGHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSEDFHLNSFNNPPRQYQKIMKRLIKRYVLQAQIDKESDEVNEGELKEIKQDISSLRYELLEEKSQNTEDLAELIRELGEKLSMEPNQEETNR
Target: TRPC6
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200