Anti-NALP12 / NLRP12 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87903-50
Article Name: Anti-NALP12 / NLRP12 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87903-50
Supplier Catalog Number: A87903-50
Alternative Catalog Number: ABC-A87903-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 862-1062 of human NLRP12 (NP_001264055.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to NALP12 / NLRP12.
Clonality: Polyclonal
Molecular Weight: 120 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: LWLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLGVLLLCEGLRHPTCKLQTLRLGICRLGSAACEGLSVVLQANHNLRELDLSFNDLGDWGLWLLAEGLQHPACRLQKLWLDSCGLTAKACENLYFTLGINQTLTDLYLTNNALGDTGVRLLCKRLSHPGCKLRVLWLFGMDLNKMTHSRLAALRVTKPYLDIGC
Target: NALP12 / NLRP12
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000