Anti-ATP1A3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87913-50
Article Name: Anti-ATP1A3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87913-50
Supplier Catalog Number: A87913-50
Alternative Catalog Number: ABC-A87913-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human ATP1A3 (NP_689509.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to ATP1A3.
Clonality: Polyclonal
Molecular Weight: 112 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
Target: ATP1A3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000