Anti-ATP1A2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87914-50
Article Name: Anti-ATP1A2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87914-50
Supplier Catalog Number: A87914-50
Alternative Catalog Number: ABC-A87914-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ATP1A2 (NP_000693.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to ATP1A2.
Clonality: Polyclonal
Molecular Weight: 112 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVL
Target: ATP1A2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500