Anti-LAPTM4B Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A8793-50
Article Name: Anti-LAPTM4B Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A8793-50
Supplier Catalog Number: A8793-50
Alternative Catalog Number: ABC-A8793-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 218-317 of human LAPTM4B (NP_060877.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to LAPTM4B.
Clonality: Polyclonal
Molecular Weight: 37 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: NSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLISCVWNCYRYINGRNSSDVLVYVTSNDTTVLLPPYDDATVNGAAKEPPPPYVSA
Target: LAPTM4B
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000