Anti-LLGL2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87936-50
Article Name: Anti-LLGL2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87936-50
Supplier Catalog Number: A87936-50
Alternative Catalog Number: ABC-A87936-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 900-1000 of mouse LLGL2 (NP_663413.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to LLGL2.
Clonality: Polyclonal
Molecular Weight: 114 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: IASCVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSTKAKKHNRPSNGNGTGLKMTSSGHVRNSKSQSDGDEKKPGPVMEHALLNDAWVLKEIQSTL
Target: LLGL2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:100