Anti-Eph receptor A5 / BSK Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87955-100
Article Name: Anti-Eph receptor A5 / BSK Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87955-100
Supplier Catalog Number: A87955-100
Alternative Catalog Number: ABC-A87955-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human EPHA5 (NP_004430.4).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Eph receptor A5 / BSK.
Clonality: Polyclonal
Molecular Weight: 115 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MRGSGPRGAGRRRPPSGGGDTPITPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNEVNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNEGASRIFIEL
Target: Eph receptor A5 / BSK
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200