Anti-ZNF598 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87956-50
Article Name: Anti-ZNF598 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87956-50
Supplier Catalog Number: A87956-50
Alternative Catalog Number: ABC-A87956-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-420 of human ZNF598 (NP_835461.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to ZNF598.
Clonality: Polyclonal
Molecular Weight: 115 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: PRCPELPPFSLFGDLEQHMRRQHELFCCRLCLQHLQIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSRSRAEARQNRHIDLQFSYAPRHSRRNEGVVGGEDYEEVDRYSRQGRVARAGTRGAQQSRRGSWRYKREEEDREVAAAVRASVAAQQQEEARRSEDQEEGGRP
Target: ZNF598
Antibody Type: Primary Antibody
Application Dilute: WB: 1:200-1:2,000