Anti-Hormone sensitive lipase / HSL Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A87973-50
Article Name: Anti-Hormone sensitive lipase / HSL Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A87973-50
Supplier Catalog Number: A87973-50
Alternative Catalog Number: ABC-A87973-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human LIPE (NP_005348.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Hormone sensitive lipase / HSL.
Clonality: Polyclonal
Molecular Weight: 81 kDa / 83 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: TLSPSTPSDVNFLLPPEDAGEEAEAKNELSPMDRGLGVRAAFPEGFHPRRSSQGATQMPLYSSPIVKNPFMSPLLAPDSMLKSLPPVHIVACALDPMLDDS
Target: Hormone sensitive lipase / HSL
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000