Anti-TCTA Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88007-100
Article Name: Anti-TCTA Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88007-100
Supplier Catalog Number: A88007-100
Alternative Catalog Number: ABC-A88007-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human TCTA (NP_071503.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to TCTA.
Clonality: Polyclonal
Molecular Weight: 11 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE
Target: TCTA
Antibody Type: Primary Antibody
Application Dilute: WB: 1:200-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200