Anti-Urm1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88010-50
Article Name: Anti-Urm1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88010-50
Supplier Catalog Number: A88010-50
Alternative Catalog Number: ABC-A88010-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human URM1 (NP_001252511.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Urm1.
Clonality: Polyclonal
Molecular Weight: 11 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSV
Target: Urm1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:100