Anti-Slit1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88433-100
Article Name: Anti-Slit1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88433-100
Supplier Catalog Number: A88433-100
Alternative Catalog Number: ABC-A88433-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1315-1534 of human SLIT1 (NP_003052.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Slit1.
Clonality: Polyclonal
Molecular Weight: 168 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: RNLYINNELQDFTKTQMKPGVVPGCEPCRKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADGPCHGHKCVHGQCVPLDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCLHGHCQASGTKGAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCQGLRLKRRKFTFECSDGTSFAEEVEKPTKCGCALCA
Target: Slit1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000