Anti-PNRC2 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A88441-50
Article Name: |
Anti-PNRC2 Antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
ABC-A88441-50 |
Supplier Catalog Number: |
A88441-50 |
Alternative Catalog Number: |
ABC-A88441-50 |
Manufacturer: |
Antibodies.com |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Mouse |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PNRC2 (NP_060231.1). |
Conjugation: |
Unconjugated |
Rabbit polyclonal antibody to PNRC2. |
Clonality: |
Polyclonal |
Molecular Weight: |
16 kDa |
Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
Form: |
Liquid |
Sequence: |
MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKERGHGYNSSAAAWQAMQNGGKNKNFPNNQSWNSSLSGPRLLFKSQANQNYAGAKFSE |
Target: |
PNRC2 |
Antibody Type: |
Primary Antibody |
Application Dilute: |
WB: 1:500-1:2,000 |