Anti-COPT2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88446-100
Article Name: Anti-COPT2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88446-100
Supplier Catalog Number: A88446-100
Alternative Catalog Number: ABC-A88446-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Slc31a2 (NP_001277447.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to COPT2.
Clonality: Polyclonal
Molecular Weight: 16 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVI
Target: COPT2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000