Anti-TCEB2 / Elongin-B Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88455-100
Article Name: Anti-TCEB2 / Elongin-B Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88455-100
Supplier Catalog Number: A88455-100
Alternative Catalog Number: ABC-A88455-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, IP, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human TCEB2 (NP_009039.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to TCEB2 / Elongin-B.
Clonality: Polyclonal
Molecular Weight: 16 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Target: TCEB2 / Elongin-B
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200, IP: 1:20-1:50