Anti-Gemin6 / SIP2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88465-100
Article Name: Anti-Gemin6 / SIP2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88465-100
Supplier Catalog Number: A88465-100
Alternative Catalog Number: ABC-A88465-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human GEMIN6 (NP_079051.9).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Gemin6 / SIP2.
Clonality: Polyclonal
Molecular Weight: 19 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYGPENCSSSNEIILSRVQDLIEGHLTASQ
Target: Gemin6 / SIP2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000