Anti-PATJ Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88478-100
Article Name: Anti-PATJ Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88478-100
Supplier Catalog Number: A88478-100
Alternative Catalog Number: ABC-A88478-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human INADL (NP_795352.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to PATJ.
Clonality: Polyclonal
Molecular Weight: 170 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MPENPATDKLQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHIPSDCSANFDFSRKGLLVFTDGSITNGNVHRPSN
Target: PATJ
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000