Anti-ATP10A Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88491-100
Article Name: Anti-ATP10A Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88491-100
Supplier Catalog Number: A88491-100
Alternative Catalog Number: ABC-A88491-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 440-690 of human ATP10A (NP_077816.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to ATP10A.
Clonality: Polyclonal
Molecular Weight: 170 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: RRCTVSGVEYSHDANAQRLARYQEADSEEEEVVPRGGSVSQRGSIGSHQSVRVVHRTQSTKSHRRTGSRAEAKRASMLSKHTAFSSPMEKDITPDPKLLEKVSECDKSLAVARHQEHLLAHLSPELSDVFDFFIALTICNTVVVTSPDQPRTKVRVRFELKSPVKTIEDFLRRFTPSCLTSGCSSIGSLAANKSSHKLGSSFPSTPSSDGMLLRLEERLGQPTSAIASNGYSSQADNWASELAQEQESERE
Target: ATP10A
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000