Anti-HOOK3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88492-50
Article Name: Anti-HOOK3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88492-50
Supplier Catalog Number: A88492-50
Alternative Catalog Number: ABC-A88492-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 489-718 of human HOOK3 (NP_115786.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to HOOK3.
Clonality: Polyclonal
Molecular Weight: 170 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: IALLQSLLDDANLRKNELETENRLVNQRLLEVQSQVEELQKSLQDQGSKAEDSVLLKKKLEEHLEKLHEANNELQKKRAIIEDLEPRFNNSSLKIEELQEALRKKEEEMKQMEERYKKYLEKAKSVIRTLDPKQNQGAAPEIQALKNQLQERDRLFHSLEKEYEKTKSQREMEEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQATSSRRSYPGHVQPATAR
Target: HOOK3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:200-1:2,000, ICC/IF: 1:50-1:200