Anti-Jagged 2 / JAG2 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A88503-100
Article Name: |
Anti-Jagged 2 / JAG2 Antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
ABC-A88503-100 |
Supplier Catalog Number: |
A88503-100 |
Alternative Catalog Number: |
ABC-A88503-100 |
Manufacturer: |
Antibodies.com |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
ICC, WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 24-200 of human JAG2 (NP_002217.3). |
Conjugation: |
Unconjugated |
Rabbit polyclonal antibody to Jagged 2 / JAG2. |
Clonality: |
Polyclonal |
Molecular Weight: |
150 kDa |
Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
Form: |
Liquid |
Sequence: |
ARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARARAGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDE |
Target: |
Jagged 2 / JAG2 |
Antibody Type: |
Primary Antibody |
Application Dilute: |
WB: 1:500-1:1,000, ICC/IF: 1:50-1:200 |