Anti-Jagged 2 / JAG2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88503-50
Article Name: Anti-Jagged 2 / JAG2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88503-50
Supplier Catalog Number: A88503-50
Alternative Catalog Number: ABC-A88503-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-200 of human JAG2 (NP_002217.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Jagged 2 / JAG2.
Clonality: Polyclonal
Molecular Weight: 150 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: ARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARARAGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDE
Target: Jagged 2 / JAG2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200