Anti-4E-T Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88511-50
Article Name: Anti-4E-T Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88511-50
Supplier Catalog Number: A88511-50
Alternative Catalog Number: ABC-A88511-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human EIF4ENIF1 (NP_001157973.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to 4E-T.
Clonality: Polyclonal
Molecular Weight: 178 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: LGGRRIGSGRIISARTFEKDHRLSDKDLRDLRDRDRERDFKDKRFRREFGDSKRVFGERRRNDSYTEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGR
Target: 4E-T
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200