Anti-Calmodulin 1 / 2 / 3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88516-50
Article Name: Anti-Calmodulin 1 / 2 / 3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88516-50
Supplier Catalog Number: A88516-50
Alternative Catalog Number: ABC-A88516-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-149 of human CALM3 (NP_005175.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Calmodulin 1 / 2 / 3.
Clonality: Polyclonal
Molecular Weight: 17 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Target: Calmodulin 1 / 2 / 3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, IHC: 1:50-1:200