Anti-TIPE2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88707-100
Article Name: Anti-TIPE2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88707-100
Supplier Catalog Number: A88707-100
Alternative Catalog Number: ABC-A88707-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human TNFAIP8L2 (NP_078851.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to TIPE2.
Clonality: Polyclonal
Molecular Weight: 18 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
Target: TIPE2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200, IP: 1:500-1:1,000