Anti-Twist Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88733-50
Article Name: Anti-Twist Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88733-50
Supplier Catalog Number: A88733-50
Alternative Catalog Number: ABC-A88733-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of Twist (NP_000465.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Twist.
Clonality: Polyclonal
Molecular Weight: 21 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEE
Target: Twist
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, IHC: 1:50-1:200